PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0014s0224.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family M-type_MADS
Protein Properties Length: 879aa    MW: 88269 Da    PI: 6.6497
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0014s0224.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.31.3e-151353242
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         ri +++ rq  f++R++g+ KKA ELSvLCd ev +iif+ 
  Vocar.0014s0224.1.p 13 RITDDRLRQDIFARRKQGLVKKAMELSVLCDCEVGLIIFGR 53
                         899************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.988452IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-18471IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-20584IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-10626IPR002100Transcription factor, MADS-box
PfamPF003192.8E-151353IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-102641IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-104162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 879 aa     Download sequence    Send to blast
MDELTRSKVQ LQRITDDRLR QDIFARRKQG LVKKAMELSV LCDCEVGLII FGRGESGPGG  60
GGQRLYQYSS INMDELLERY AAAVAEPHER RKNGELLRHY YELSPDEDGE EDDGGASTSL  120
AAAAANMAAV DSIILAGGGR RIDSREVPPG VLKRMRMNSP SGFGAGGVLT DHMPAGASGV  180
PRPMQMGGSG LPGAQIGHLA VGQGGMMSNG MGSLVPSGPG APLRRVGGPS IPLEGIKAAG  240
FLDKRNYPVS PRSDKAFEEI TAEFDKITES RSQRAGNSGR QNTPTVLQPL SSTLAAQQKQ  300
LQQILQQQRQ QQQQPQQQQA GGAKRFKPLS IMVPELQTHP IIPTNLTPLS SAPVAGVAAP  360
AAPPGAGSES LGHVGANGSG PQRPHLQQQQ QLQPHPSSPF NSSLQHAQHS QHHHQQQQQQ  420
QLSSPQQQQL GVNLPPRPPL GRLGIGPRPP YPQPHGSPLI AVSSGTQHGN QRFPGSSTSP  480
PGPMAISPTA AAAGPQLSAA ANGPGEAGAL AVPMEVEGGD TGSGGNDSGA GHGPFLLGRR  540
TGGALVEDGL GSMLGASAFR TSLDGSAALL AMPSPPSHGG TNALFGSLDG GPLSMRSSGH  600
GILGSLSSLD RGASLGLGGL AMSLESPGGP MGLDTALRGL APMDGLDWQS MSPSTGNGDG  660
QAGGGGGFSD EGEGGTVLDG LIVRGTALSK LAPEALEAAI GPSPDAGGGG TPTSARARMS  720
LSAFSGHAVT STAAAAAGNQ PDAGTSADPY PQPLLSSGRG GVAGQDASAG ASTGAGTAQE  780
RQEAAGGPGT RTPGETGSSR GGNAGMAAAG SMGLTPELSL NDMGFGGGSA DAAAAAAAVA  840
VPGRQGEGRG TVSEVGRALN LSGGSRTNAT QDAWGPLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-21497185Myocyte-specific enhancer factor 2B
1tqe_Q1e-21497185Myocyte-specific enhancer factor 2B
1tqe_R1e-21497185Myocyte-specific enhancer factor 2B
1tqe_S1e-21497185Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002958048.10.0MADS box protein, partial
TrEMBLD8UH900.0D8UH90_VOLCA; MADS box protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP36561314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.23e-15MIKC_MADS family protein